Product Browser

Last updated: 2017/9/17
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PLCG1 polyclonal antibody (A01)

  • Catalog # : H00005335-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PLCG1.
  • Immunogen:
  • PLCG1 (NP_002651, 1192 a.a. ~ 1291 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • LKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005335-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5335
  • Gene Name:
  • PLCG1
  • Gene Alias:
  • PLC-II,PLC1,PLC148,PLCgamma1
  • Gene Description:
  • phospholipase C, gamma 1
  • Gene Summary:
  • The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of receptor-mediated tyrosine kinase activators. For example, when activated by SRC, the encoded protein causes the Ras guanine nucleotide exchange factor RasGRP1 to translocate to the Golgi, where it activates Ras. Also, this protein has been shown to be a major substrate for heparin-binding growth factor 1 (acidic fibroblast growth factor)-activated tyrosine kinase. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • 1-phosphatidyl-D-myo-inositol-4,5-bisphosphate,1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1,OTTHUMP00000031787,OTTHUMP00000178982,PLC-gamma-1,inositoltrisphosphohydrolase,monophosphatidylinositol phosphodiesterase,phosphatidylinositol
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook