Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PLCD1 polyclonal antibody (A01)

  • Catalog # : H00005333-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PLCD1.
  • Immunogen:
  • PLCD1 (AAH50382, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MDSGRDFLTLHGLQDDEDLQALLKGSQLLKVKSSSWRRERFYKLQEDCKTIWQESRKVMRTPESQLFSIEDIQEVRMGHRTEGLEKFARDVPEDRCFSIV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5333
  • Gene Name:
  • PLCD1
  • Gene Alias:
  • -
  • Gene Description:
  • phospholipase C, delta 1
  • Gene Summary:
  • Phosphoinositide-specific phospholipase C (PLC) acts as a signal transducer that generates 2 second messengers, diacylglycerol and inositol 1,4,5-trisphosphate, by hydrolyzing inositol phospholipids. PLC comprises a diverse family of enzymes that differ in structure and tissue distribution (Berridge, 1993 [PubMed 8381210]).[supplied by OMIM
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook