PLAUR (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PLAUR full-length ORF ( AAH02788, 1 a.a. - 335 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
62.59
Interspecies Antigen Sequence
Mouse (61); Rat (59)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PLAUR
Entrez GeneID
5329GeneBank Accession#
BC002788Protein Accession#
AAH02788Gene Name
PLAUR
Gene Alias
CD87, UPAR, URKR
Gene Description
plasminogen activator, urokinase receptor
Omim ID
173391Gene Ontology
HyperlinkGene Summary
This gene encodes the receptor for urokinase plasminogen activator and, given its role in localizing and promoting plasmin formation, likely influences many normal and pathological processes related to cell-surface plasminogen activation and localized degradation of the extracellular matrix. It binds both the proprotein and mature forms of urokinase plasminogen activator and permits the activation of the receptor-bound pro-enzyme by plasmin. The protein lacks transmembrane or cytoplasmic domains and may be anchored to the plasma membrane by a glycosyl-phosphatidylinositol (GPI) moiety following cleavage of the nascent polypeptide near its carboxy-terminus. However, a soluble protein is also produced in some cell types. Alternative splicing results in multiple transcript variants encoding different isoforms. The proprotein experiences several post-translational cleavage reactions that have not yet been fully defined. [provided by RefSeq
Other Designations
monocyte activation antigen Mo3|u-plasminogen activator receptor form 2
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Epileptic and developmental disorders of the speech cortex: ligand/receptor interaction of wild-type and mutant SRPX2 with the plasminogen activator receptor uPAR.
Barbara Royer-Zemmour, Magali Ponsole-Lenfant, Hyam Gara, Patrice Roll, Christian Leveque, Annick Massacrier, Geraldine Ferracci, Jennifer Cillario, Andree Robaglia-Schlupp, Renaud Vincentelli, Pierre Cau, Pierre Szepetowski.
Human Molecular Genetics 2008 Dec; 17(23):3617.
Application:Func, PI, Recombinant protein.
-
Epileptic and developmental disorders of the speech cortex: ligand/receptor interaction of wild-type and mutant SRPX2 with the plasminogen activator receptor uPAR.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com