Product Browser

Last updated: 2016/12/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PLA2G5 (Human) Recombinant Protein (P01)

  • Catalog # : H00005322-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PLA2G5 full-length ORF ( NP_000920.1, 1 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGTDWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILCS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 42.1
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005322-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5322
  • Gene Name:
  • PLA2G5
  • Gene Alias:
  • DKFZp686C2294,GV-PLA2,MGC46205,PLA2-10,hVPLA(2)
  • Gene Description:
  • phospholipase A2, group V
  • Gene Summary:
  • This gene is a member of the secretory phospholipase A2 family. It is located in a tightly-linked cluster of secretory phospholipase A2 genes on chromosome 1. The encoded enzyme catalyzes the hydrolysis of membrane phospholipids to generate lysophospholipids and free fatty acids including arachidonic acid. It preferentially hydrolyzes linoleoyl-containing phosphatidylcholine substrates. Secretion of this enzyme is thought to induce inflammatory responses in neighboring cells. Alternatively spliced transcript variants have been found, but their full-length nature has not been determined. [provided by RefSeq
  • Other Designations:
  • Ca2+-dependent phospholipase A2,OTTHUMP00000002785,OTTHUMP00000044655,phosphatidylcholine 2-acylhydrolase
  • RSS
  • YouTube
  • Linkedin
  • Facebook