Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PLA2G1B (Human) Recombinant Protein (P01)

  • Catalog # : H00005319-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PLA2G1B full-length ORF ( AAH05386, 17 a.a. - 70 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • SGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKQKQRV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 31.68
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005319-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5319
  • Gene Name:
  • PLA2G1B
  • Gene Alias:
  • MGC119834,MGC119835,PLA2,PLA2A,PPLA2
  • Gene Description:
  • phospholipase A2, group IB (pancreas)
  • Gene Summary:
  • Phospholipase A2 (EC 3.1.1.4) catalyzes the release of fatty acids from glycero-3-phosphocholines. The best known varieties are the digestive enzymes secreted as zymogens by the pancreas of mammals. Sequences of pancreatic PLA2 enzymes from a variety of mammals have been reported. One striking feature of these enzymes is their close homology to venom phospholipases of snakes. Other forms of PLA2 have been isolated from brain, liver, lung, spleen, intestine, macrophages, leukocytes, erythrocytes, inflammatory exudates, chondrocytes, and platelets (Seilhamer et al., 1986 [PubMed 3028739]) .[supplied by OMIM
  • Other Designations:
  • phospholipase A2, group IB
  • RSS
  • YouTube
  • Linkedin
  • Facebook