Product Browser

Last updated: 2017/4/23
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PKP1 polyclonal antibody (A01)

  • Catalog # : H00005317-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PKP1.
  • Immunogen:
  • PKP1 (NP_000290, 61 a.a. ~ 159 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • TLSHSNRGSMYDGLADNYNYGTTSRSSYYSKFQAGNGSWGYPIYNGTLKREPDNRRFSSYSQMENWSRHYPRGSCNTTGAGSDICFMQKIKASRSEPDL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005317-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • PKP1 polyclonal antibody (A01), Lot # 051012JCO1 Western Blot analysis of PKP1 expression in HL-60 ( Cat # L014V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5317
  • Gene Name:
  • PKP1
  • Gene Alias:
  • B6P,MGC138829
  • Gene Description:
  • plakophilin 1 (ectodermal dysplasia/skin fragility syndrome)
  • Gene Summary:
  • This gene encodes a member of the arm-repeat (armadillo) and plakophilin gene families. Plakophilin proteins contain numerous armadillo repeats, localize to cell desmosomes and nuclei, and participate in linking cadherins to intermediate filaments in the cytoskeleton. This protein may be involved in molecular recruitment and stabilization during desmosome formation. Mutations in this gene have been associated with the ectodermal dysplasia/skin fragility syndrome. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000033848,OTTHUMP00000033849,band 6 protein,plakophilin 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook