PITX2 monoclonal antibody (M01), clone 2G6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant PITX2.
Immunogen
PITX2 (AAH13998, 1 a.a. ~ 324 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MNCMKGPLHLEHRAAGTKLSAVSSSSCHHPQPLAMASVLAPGQPRSLDSSKHRLEVHTISDTSSPEAAEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRLKAKQHSSFGYASVQNPASNLSACQYAVDRPV
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (61.38 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PITX2 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PITX2 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — PITX2
Entrez GeneID
5308GeneBank Accession#
BC013998Protein Accession#
AAH13998Gene Name
PITX2
Gene Alias
ARP1, Brx1, IDG2, IGDS, IGDS2, IHG2, IRID2, MGC111022, MGC20144, Otlx2, PTX2, RGS, RIEG, RIEG1, RS
Gene Description
paired-like homeodomain 2
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. The encoded protein acts as a transcription factor and regulates procollagen lysyl hydroxylase gene expression. This protein plays a role in the terminal differentiation of somatotroph and lactotroph cell phenotypes, is involved in the development of the eye, tooth and abdominal organs, and acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. Mutations in this gene are associated with Axenfeld-Rieger syndrome, iridogoniodysgenesis syndrome, and sporadic cases of Peters anomaly. A similar protein in other vertebrates is involved in the determination of left-right asymmetry during development. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq
Other Designations
OTTHUMP00000163736|all1-responsive gene 1|paired-like homeodomain transcription factor 2|pituitary homeo box 2|rieg bicoid-related homeobox transcription factor 1|solurshin
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Fabrication of functional ameloblasts from hiPSCs for dental application.
Ka-Hwa Kim, Eun-Jung Kim, Hyun-Yi Kim, Shujin Li, Han-Sung Jung.
Frontiers in Cell and Developmental Biology 2023 Jun; 11:1164811.
Application:IF, Human, human-induced pluripotent stem cells.
-
TWIST1, a gene associated with Saethre-Chotzen syndrome, regulates extraocular muscle organization in mouse.
Mary C. Whitman, Nicole M. Gilette, Jessica L. Bell, Seoyoung A. Kim, Max Tischfield, Elizabeth C. Engle.
Developmental Biology 2022 Oct; 490:126.
Application:IF, Mouse, Mouse extraocular muscles.
-
Mechanotransductive Differentiation of Hair Follicle Stem Cells Derived from Aged Eyelid Skin into Corneal Endothelial-Like Cells.
Christian Olszewski, Jessika Maassen, Rebecca Guenther, Claudia Skazik-Voogt, Angela Gutermuth.
Stem Cell Reviews and Reports 2022 Jun; 18(5):1668.
Application:IF, Human, Human hair follicle derived stem cells.
-
Directed differentiation of periocular mesenchyme from human embryonic stem cells.
Lovatt M, Yam GH, Peh GS, Colman A, Dunn NR, Mehta JS.
Differentiation 2018 Jan; 99:62.
Application:WB-Ce, Human, Human embryonic stem cells.
-
PITX2 is involved in stress response in cultured human trabecular meshwork cells through regulation of SLC13A3.
Strungaru MH, Footz T, Liu Y, Berry FB, Belleau P, Semina EV, Raymond V, Walter MA.
Investigative Ophthalmology & Visual Science 2011 Nov; 10(11):M111.01170.
Application:ChIP, Human, Non-pigmented ciliary epithelium cells.
-
Human PRKC Apoptosis WT1 Regulator Is a Novel PITX2-interacting Protein That Regulates PITX2 Transcriptional Activity in Ocular Cells.
Acharya M, Lingenfelter DJ, Huang L, Gage PJ, Walter MA.
The Journal of Biological Chemistry 2009 Oct; 284(50):34829.
Application:IP-WB, Human, COS-7, HTM cells.
-
Fabrication of functional ameloblasts from hiPSCs for dental application.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com