Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PITX1 polyclonal antibody (A01)

  • Catalog # : H00005307-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PITX1.
  • Immunogen:
  • PITX1 (NP_002644, 225 a.a. ~ 313 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005307-A01
    Western Blot detection against Immunogen (35.9 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5307
  • Gene Name:
  • PITX1
  • Gene Alias:
  • BFT,POTX,PTX1
  • Gene Description:
  • paired-like homeodomain 1
  • Gene Summary:
  • This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family are involved in organ development and left-right asymmetry. This protein acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. [provided by RefSeq
  • Other Designations:
  • hindlimb expressed homeobox protein backfoot,paired-like homeodomain transcription factor 1,pituitary homeo box 1,pituitary otx-related factor
  • RSS
  • YouTube
  • Linkedin
  • Facebook