Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PIK3CD polyclonal antibody (A01)

  • Catalog # : H00005293-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PIK3CD.
  • Immunogen:
  • PIK3CD (NP_005017, 138 a.a. ~ 247 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • DFRAKMCQFCEEAAARRQQLGWEAWLQYSFPLQLEPSAQTWGPGTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGRH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5293
  • Gene Name:
  • PIK3CD
  • Gene Alias:
  • p110D
  • Gene Description:
  • phosphoinositide-3-kinase, catalytic, delta polypeptide
  • Gene Summary:
  • Phosphoinositide 3-kinases (PI3Ks) phosphorylate the 3-prime OH position of the inositol ring of inositol lipids. See MIM 602838. The class I PI3Ks display a broad phosphoinositide lipid substrate specificity and include p110-alpha (MIM 171834), p110-beta (MIM 602925), and p110-gamma (MIM 601232). p110-alpha and p110-beta interact with SH2/SH3-domain-containing p85 adaptor proteins (see MIM 171833) and with GTP-bound Ras.[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000001595,phosphatidylinositol 3-kinase, catalytic, delta polypeptide,phosphoinositide-3-kinase C
  • RSS
  • YouTube
  • Linkedin
  • Facebook