Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PIK3CB (Human) Recombinant Protein (Q01)

  • Catalog # : H00005291-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PIK3CB partial ORF ( NP_006210, 147 a.a. - 256 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • EFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDEVSPYDYVLQVSGRVEY
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005291-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5291
  • Gene Name:
  • PIK3CB
  • Gene Alias:
  • DKFZp779K1237,MGC133043,PI3K,PI3KCB,PI3Kbeta,PIK3C1,p110-BETA
  • Gene Description:
  • phosphoinositide-3-kinase, catalytic, beta polypeptide
  • Gene Summary:
  • Phosphoinositide 3-kinases (PI3Ks) phosphorylate the 3-prime OH position of the inositol ring of inositol lipids. They have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. PI3Ks are composed of a 110-kD catalytic subunit, such as PIK3CB, and an 85-kD adaptor subunit (Hu et al., 1993 [PubMed 8246984]).[supplied by OMIM
  • Other Designations:
  • PI3-kinase p110 subunit beta,PtdIns-3-kinase p110,phosphatidylinositol 3-kinase, catalytic, beta polypeptide
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook