Product Browser

Last updated: 2017/5/28
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PIK3CB polyclonal antibody (A01)

  • Catalog # : H00005291-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PIK3CB.
  • Immunogen:
  • PIK3CB (NP_006210, 147 a.a. ~ 256 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • EFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDEVSPYDYVLQVSGRVEY
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5291
  • Gene Name:
  • PIK3CB
  • Gene Alias:
  • DKFZp779K1237,MGC133043,PI3K,PI3KCB,PI3Kbeta,PIK3C1,p110-BETA
  • Gene Description:
  • phosphoinositide-3-kinase, catalytic, beta polypeptide
  • Gene Summary:
  • Phosphoinositide 3-kinases (PI3Ks) phosphorylate the 3-prime OH position of the inositol ring of inositol lipids. They have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. PI3Ks are composed of a 110-kD catalytic subunit, such as PIK3CB, and an 85-kD adaptor subunit (Hu et al., 1993 [PubMed 8246984]).[supplied by OMIM
  • Other Designations:
  • PI3-kinase p110 subunit beta,PtdIns-3-kinase p110,phosphatidylinositol 3-kinase, catalytic, beta polypeptide
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook