Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PIK3CA polyclonal antibody (A01)

  • Catalog # : H00005290-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PIK3CA.
  • Immunogen:
  • PIK3CA (NP_006209, 959 a.a. ~ 1068 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • DFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5290
  • Gene Name:
  • PIK3CA
  • Gene Alias:
  • MGC142161,MGC142163,PI3K,p110-alpha
  • Gene Description:
  • phosphoinositide-3-kinase, catalytic, alpha polypeptide
  • Gene Summary:
  • Phosphatidylinositol 3-kinase is composed of an 85 kDa regulatory subunit and a 110 kDa catalytic subunit. The protein encoded by this gene represents the catalytic subunit, which uses ATP to phosphorylate PtdIns, PtdIns4P and PtdIns(4,5)P2. This gene has been found to be oncogenic and has been implicated in cervical cancers. [provided by RefSeq
  • Other Designations:
  • PI3-kinase p110 subunit alpha,PtdIns-3-kinase p110,phosphatidylinositol 3-kinase, catalytic, 110-KD, alpha,phosphatidylinositol 3-kinase, catalytic, alpha polypeptide,phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit, alpha isoform
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook