PIK3C2A polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant PIK3C2A.
Immunogen
PIK3C2A (NP_002636, 1577 a.a. ~ 1686 a.a) partial recombinant protein with GST tag.
Sequence
MVMHIKDLVTEDGADPNPYVKTYLLPDNHKTSKRKTKISRKTRNPTFNEMLVYSGYSKETLRQRELQLSVLSAESLRENFFLGGVTLPLKDFNLSKETVKWYQLTAATYL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (97)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
ELISA
-
Gene Info — PIK3C2A
Entrez GeneID
5286GeneBank Accession#
NM_002645Protein Accession#
NP_002636Gene Name
PIK3C2A
Gene Alias
CPK, DKFZp686L193, MGC142218, PI3-K-C2(ALPHA), PI3-K-C2A
Gene Description
phosphoinositide-3-kinase, class 2, alpha polypeptide
Omim ID
603601Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the phosphoinositide 3-kinase (PI3K) family. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain as well as a C-terminal C2 domain, a characteristic of class II PI3-kinases. C2 domains act as calcium-dependent phospholipid binding motifs that mediate translocation of proteins to membranes, and may also mediate protein-protein interactions. The PI3-kinase activity of this protein is not sensitive to nanomolar levels of the inhibitor wortmanin. This protein was shown to be able to be activated by insulin and may be involved in integrin-dependent signaling. [provided by RefSeq
Other Designations
C2-containing phosphatidylinositol kinase|PI3K-C2alpha
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
The SH3 domain of postsynaptic density 95 mediates inflammatory pain through phosphatidylinositol-3-kinase recruitment.
Arbuckle MI, Komiyama NH, Delaney A, Coba M, Garry EM, Rosie R, Allchorne AJ, Forsyth LH, Bence M, Carlisle HJ, O'Dell TJ, Mitchell R, Fleetwood-Walker SM, Grant SG.
EMBO Reports 2010 Jun; 11(6):473.
Application:WB-Ti, Mouse, Hippocampal, Spinal cord samples.
-
The SH3 domain of postsynaptic density 95 mediates inflammatory pain through phosphatidylinositol-3-kinase recruitment.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com