PIGC (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PIGC partial ORF ( NP_002633, 1 a.a. - 54 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MYAQPVTNTKEVKWQKVLYERQPFPDNYVDRRFLEELRKNIHARKYQYWAVVFE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
31.68
Interspecies Antigen Sequence
Mouse (89); Rat (87)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PIGC
Entrez GeneID
5279GeneBank Accession#
NM_002642Protein Accession#
NP_002633Gene Name
PIGC
Gene Alias
GPI2, MGC2049
Gene Description
phosphatidylinositol glycan anchor biosynthesis, class C
Omim ID
601730Gene Ontology
HyperlinkGene Summary
This gene encodes an endoplasmic reticulum associated protein that is involved in glycosylphosphatidylinositol (GPI) lipid anchor biosynthesis. The GPI lipid anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. The encoded protein is one subunit of the GPI N-acetylglucosaminyl (GlcNAc) transferase that transfers GlcNAc to phosphatidylinositol (PI) on the cytoplasmic side of the endoplasmic reticulum. Two alternatively spliced transcripts that encode the same protein have been found for this gene. A pseudogene on chromosome 11 has also been characterized. [provided by RefSeq
Other Designations
OTTHUMP00000032652|OTTHUMP00000032653|phosphatidylinositol glycan, class C|phosphatidylinositol-glycan biosynthesis, class C protein
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com