Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PIGC (Human) Recombinant Protein (Q01)

  • Catalog # : H00005279-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PIGC partial ORF ( NP_002633, 1 a.a. - 54 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MYAQPVTNTKEVKWQKVLYERQPFPDNYVDRRFLEELRKNIHARKYQYWAVVFE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 31.68
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005279-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5279
  • Gene Name:
  • PIGC
  • Gene Alias:
  • GPI2,MGC2049
  • Gene Description:
  • phosphatidylinositol glycan anchor biosynthesis, class C
  • Gene Summary:
  • This gene encodes an endoplasmic reticulum associated protein that is involved in glycosylphosphatidylinositol (GPI) lipid anchor biosynthesis. The GPI lipid anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. The encoded protein is one subunit of the GPI N-acetylglucosaminyl (GlcNAc) transferase that transfers GlcNAc to phosphatidylinositol (PI) on the cytoplasmic side of the endoplasmic reticulum. Two alternatively spliced transcripts that encode the same protein have been found for this gene. A pseudogene on chromosome 11 has also been characterized. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000032652,OTTHUMP00000032653,phosphatidylinositol glycan, class C,phosphatidylinositol-glycan biosynthesis, class C protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook