PIGC monoclonal antibody (M01), clone 1G2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PIGC is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (31.68 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PIGC.
Immunogen
PIGC (NP_002633, 1 a.a. ~ 54 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MYAQPVTNTKEVKWQKVLYERQPFPDNYVDRRFLEELRKNIHARKYQYWAVVFE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89); Rat (87)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (31.68 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PIGC is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — PIGC
Entrez GeneID
5279GeneBank Accession#
NM_002642Protein Accession#
NP_002633Gene Name
PIGC
Gene Alias
GPI2, MGC2049
Gene Description
phosphatidylinositol glycan anchor biosynthesis, class C
Omim ID
601730Gene Ontology
HyperlinkGene Summary
This gene encodes an endoplasmic reticulum associated protein that is involved in glycosylphosphatidylinositol (GPI) lipid anchor biosynthesis. The GPI lipid anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. The encoded protein is one subunit of the GPI N-acetylglucosaminyl (GlcNAc) transferase that transfers GlcNAc to phosphatidylinositol (PI) on the cytoplasmic side of the endoplasmic reticulum. Two alternatively spliced transcripts that encode the same protein have been found for this gene. A pseudogene on chromosome 11 has also been characterized. [provided by RefSeq
Other Designations
OTTHUMP00000032652|OTTHUMP00000032653|phosphatidylinositol glycan, class C|phosphatidylinositol-glycan biosynthesis, class C protein
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com