Product Browser

Last updated: 2017/9/17
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PIGC polyclonal antibody (A01)

  • Catalog # : H00005279-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PIGC.
  • Immunogen:
  • PIGC (NP_002633, 1 a.a. ~ 54 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MYAQPVTNTKEVKWQKVLYERQPFPDNYVDRRFLEELRKNIHARKYQYWAVVFE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005279-A01
    Western Blot detection against Immunogen (32.05 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5279
  • Gene Name:
  • PIGC
  • Gene Alias:
  • GPI2,MGC2049
  • Gene Description:
  • phosphatidylinositol glycan anchor biosynthesis, class C
  • Gene Summary:
  • This gene encodes an endoplasmic reticulum associated protein that is involved in glycosylphosphatidylinositol (GPI) lipid anchor biosynthesis. The GPI lipid anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. The encoded protein is one subunit of the GPI N-acetylglucosaminyl (GlcNAc) transferase that transfers GlcNAc to phosphatidylinositol (PI) on the cytoplasmic side of the endoplasmic reticulum. Two alternatively spliced transcripts that encode the same protein have been found for this gene. A pseudogene on chromosome 11 has also been characterized. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000032652,OTTHUMP00000032653,phosphatidylinositol glycan, class C,phosphatidylinositol-glycan biosynthesis, class C protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook