Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PIGA (Human) Recombinant Protein (Q01)

  • Catalog # : H00005277-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PIGA partial ORF ( NP_002632, 194 a.a. - 293 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • LRAALNPEIVSVIPNAVDPTDFTPDPFRRHDSITIVVVSRLVYRKGIDLLSGIIPELCQKYPDLNFIIGGEGPKRIILEEVRERYQLHDRVRLLGALEHK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005277-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5277
  • Gene Name:
  • PIGA
  • Gene Alias:
  • GPI3,PIG-A
  • Gene Description:
  • phosphatidylinositol glycan anchor biosynthesis, class A
  • Gene Summary:
  • This gene encodes a protein required for synthesis of N-acetylglucosaminyl phosphatidylinositol (GlcNAc-PI), the first intermediate in the biosynthetic pathway of GPI anchor. The GPI anchor is a glycolipid found on many blood cells and which serves to anchor proteins to the cell surface. Paroxysmal nocturnal hemoglobinuria, an acquired hematologic disorder, has been shown to result from mutations in this gene. Alternate splice variants have been characterized. [provided by RefSeq
  • Other Designations:
  • GLCNAC-PI synthesis protein,GPI anchor biosynthesis,OTTHUMP00000022959,phosphatidylinositol N-acetylglucosaminyltransferase subunit A,phosphatidylinositol glycan, class A (paroxysmal nocturnal hemoglobinuria),phosphatidylinositol-glycan biosynthesis, clas
  • RSS
  • YouTube
  • Linkedin
  • Facebook