SERPINI1 monoclonal antibody (M01), clone 1D10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant SERPINI1.
Immunogen
SERPINI1 (AAH18043, 17 a.a. ~ 410 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQEEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLYDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (87); Rat (88)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (69.08 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SERPINI1 monoclonal antibody (M01), clone 1D10 Western Blot analysis of SERPINI1 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SERPINI1 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SERPINI1 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — SERPINI1
Entrez GeneID
5274GeneBank Accession#
BC018043Protein Accession#
AAH18043Gene Name
SERPINI1
Gene Alias
DKFZp781N13156, PI12, neuroserpin
Gene Description
serpin peptidase inhibitor, clade I (neuroserpin), member 1
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The protein is primarily secreted by axons in the brain, and preferentially reacts with and inhibits tissue-type plasminogen activator. It is thought to play a role in the regulation of axonal growth and the development of synaptic plasticity. Mutations in this gene result in familial encephalopathy with neuroserpin inclusion bodies (FENIB), which is a dominantly inherited form of familial encephalopathy and epilepsy characterized by the accumulation of mutant neuroserpin polymers. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
Other Designations
neuroserpin|serine (or cysteine) proteinase inhibitor, clade I (neuroserpin), member 1
-
Interactome
-
Disease
-
Publication Reference
-
Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
Prunotto M, Farina A, Lane L, Pernin A, Schifferli J, Hochstrasser DF, Lescuyer P, Moll S.
Journal of Proteomics 2013 Jan; 82:193.
Application:IHC-P, Human, Normal renal tissue.
-
Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com