Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SERPINB10 monoclonal antibody (M09), clone 2B8

  • Catalog # : H00005273-M09
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant SERPINB10.
  • Immunogen:
  • SERPINB10 (NP_005015.1, 46 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • AKGTTAAQMAQVLQFNRDQGVKCDPESEKKRKMEFNLSNSEEIHSDFQTLISEILKPNDDYLLKTANAIYGEKTYAFHNKYLEDMKTYFGAEPQPVNFVE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Lambda
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005273-M09
    Western Blot detection against Immunogen (36.74 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SERPINB10 expression in transfected 293T cell line by SERPINB10 monoclonal antibody (M09), clone 2B8.

    Lane 1: SERPINB10 transfected lysate (Predicted MW: 45.4 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5273
  • Gene Name:
  • SERPINB10
  • Gene Alias:
  • PI10,bomapin
  • Gene Description:
  • serpin peptidase inhibitor, clade B (ovalbumin), member 10
  • Other Designations:
  • OTTHUMP00000066999,protease inhibitor 10 (ovalbumin type, bomapin),serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 10
  • RSS
  • YouTube
  • Linkedin
  • Facebook