Product Browser

Last updated: 2022/5/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

SERPINB9 MaxPab mouse polyclonal antibody (B01P) MaxPab

  • Catalog # : H00005272-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human SERPINB9 protein.
  • Immunogen:
  • SERPINB9 (NP_004146.1, 1 a.a. ~ 376 a.a) full-length human protein.
  • Sequence:
  • METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Interspecies Antigen Sequence:
  • Mouse (69); Rat (69)
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SERPINB9 expression in transfected 293T cell line (H00005272-T01) by SERPINB9 MaxPab polyclonal antibody.

    Lane 1: SERPINB9 transfected lysate(41.36 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 5272
  • Gene Name:
  • SERPINB9
  • Gene Alias:
  • CAP-3,CAP3,PI9
  • Gene Description:
  • serpin peptidase inhibitor, clade B (ovalbumin), member 9
  • Gene Summary:
  • PI9 belongs to the large superfamily of serine proteinase inhibitors (serpins), which bind to and inactivate serine proteinases. These interactions are involved in many cellular processes, including coagulation, fibrinolysis, complement fixation, matrix remodeling, and apoptosis (Sprecher et al., 1995 [PubMed 8530382]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000015954,protease inhibitor 9 (ovalbumin type),serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 9
  • RSS
  • YouTube
  • Linkedin
  • Facebook