Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SERPINE2 monoclonal antibody (M01), clone 3G12

  • Catalog # : H00005270-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant SERPINE2.
  • Immunogen:
  • SERPINE2 (NP_006207, 72 a.a. ~ 172 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • RTKKQLAMVMRYGVNGVGKILKKINKAIVSKKNKDIVTVANAVFVKNASEIEVPFVTRNKDVFQCEVRNVNFEDPASACDSINAWVKNETRDMIDNLLSPD
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005270-M01
    Western Blot detection against Immunogen (36.85 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SERPINE2 expression in transfected 293T cell line by SERPINE2 monoclonal antibody (M01), clone 3G12.

    Lane 1: SERPINE2 transfected lysate(44.002 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged SERPINE2 is approximately 10ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5270
  • Gene Name:
  • SERPINE2
  • Gene Alias:
  • GDN,PI7,PN1,PNI
  • Gene Description:
  • serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 2
  • Other Designations:
  • glial-derived neurite promoting factor,glial-derived nexin 1,plasminogen activator inhibitor type 1, member 2,protease inhibitor 7 (protease nexin I),serine (or cysteine) proteinase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), membe
  • RSS
  • YouTube
  • Linkedin
  • Facebook