SERPINB5 monoclonal antibody (M01), clone 1F7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
SERPINB5 monoclonal antibody (M01), clone 1F7. Western Blot analysis of SERPINB5 expression in human pancreas.
Western Blot (Cell lysate)
SERPINB5 monoclonal antibody (M01), clone 1F7. Western Blot analysis of SERPINB5 expression in HeLa.
Western Blot (Transfected lysate)
Western Blot analysis of SERPINB5 expression in transfected 293T cell line by SERPINB5 monoclonal antibody (M01), clone 1F7.
Lane 1: SERPINB5 transfected lysate (Predicted MW: 25.52 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SERPINB5 is 0.1 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to SERPINB5 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (51.15 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant SERPINB5.
Immunogen
SERPINB5 (AAH20713, 1 a.a. ~ 231 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDALQLANSAFAVDLFKQLCEKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHFENVKDVPFGFQTVTSDVNKPSSFYSLKLIKRLYVDKSLNLSTEFISSTKRPYAKELETVDFKDKLEETKGQINNSIKDLTDGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFPESETKECPFRVNRVCGAACSSKRSPIIDVKNDRDRVGHKSIPMRNLRARPAKCLS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (51.15 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SERPINB5 monoclonal antibody (M01), clone 1F7. Western Blot analysis of SERPINB5 expression in human pancreas.Western Blot (Cell lysate)
SERPINB5 monoclonal antibody (M01), clone 1F7. Western Blot analysis of SERPINB5 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of SERPINB5 expression in transfected 293T cell line by SERPINB5 monoclonal antibody (M01), clone 1F7.
Lane 1: SERPINB5 transfected lysate (Predicted MW: 25.52 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SERPINB5 is 0.1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to SERPINB5 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — SERPINB5
Entrez GeneID
5268GeneBank Accession#
BC020713Protein Accession#
AAH20713Gene Name
SERPINB5
Gene Alias
PI5, maspin
Gene Description
serpin peptidase inhibitor, clade B (ovalbumin), member 5
Omim ID
154790Gene Ontology
HyperlinkGene Summary
clade B (ovalbumin)
Other Designations
protease inhibitor 5 (maspin)|serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 5
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com