PI3 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PI3 full-length ORF ( AAH10952, 1 a.a. - 117 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
38.61
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PI3
Entrez GeneID
5266GeneBank Accession#
BC010952Protein Accession#
AAH10952Gene Name
PI3
Gene Alias
ESI, MGC13613, SKALP, WAP3, WFDC14, cementoin
Gene Description
peptidase inhibitor 3, skin-derived
Omim ID
182257Gene Ontology
HyperlinkGene Summary
This gene encodes an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria. The protein contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines. [provided by RefSeq
Other Designations
OTTHUMP00000031100|WAP four-disulfide core domain 14|elafin|elastase-specific inhibitor|protease inhibitor 3, skin-derived (SKALP)|skin-derived antileukoproteinase
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com