Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PI3 (Human) Recombinant ProteinHuPro Protein

  • Catalog # : H00005266-H01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Purified PI3 (NP_002629.1, 61 a.a. - 117 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
  • Transfected Cell Line:
  • Human HEK293T cells
  • Sequence:
  • AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 11.55
  • Form:
  • Liquid
  • Preparation Method:
  • Transfection of pSuper-PI3 plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column.
  • Purification:
  • Strep-Tactin affinity columns
  • Concentration:
  • ≥ 10 ug/ml
  • Activity:
  • Not Tested
  • Quality Control Testing:
  • SDS-PAGE

    QC Testing of H00005266-H01
  • Storage Buffer:
  • 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Application Image
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Gene Information
  • Entrez GeneID:
  • 5266
  • Gene Name:
  • PI3
  • Gene Alias:
  • ESI,MGC13613,SKALP,WAP3,WFDC14,cementoin
  • Gene Description:
  • peptidase inhibitor 3, skin-derived
  • Gene Summary:
  • This gene encodes an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria. The protein contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000031100,WAP four-disulfide core domain 14,elafin,elastase-specific inhibitor,protease inhibitor 3, skin-derived (SKALP),skin-derived antileukoproteinase
  • RSS
  • YouTube
  • Linkedin
  • Facebook