Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SERPINA1 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00005265-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human SERPINA1 protein.
  • Immunogen:
  • SERPINA1 (AAH15642.1, 1 a.a. ~ 418 a.a) full-length human protein.
  • Sequence:
  • MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQATTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • SERPINA1 MaxPab rabbit polyclonal antibody. Western Blot analysis of SERPINA1 expression in human stomach.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SERPINA1 expression in transfected 293T cell line (H00005265-T01) by SERPINA1 MaxPab polyclonal antibody.

    Lane 1: SERPINA1 transfected lysate(46.7 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of SERPINA1 transfected lysate using anti-SERPINA1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SERPINA1 MaxPab mouse polyclonal antibody (B01) (H00005265-B01).
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 5265
  • Gene Name:
  • SERPINA1
  • Gene Alias:
  • A1A,A1AT,AAT,MGC23330,MGC9222,PI,PI1,PRO2275
  • Gene Description:
  • serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
  • Gene Summary:
  • The protein encoded by this gene is secreted and is a serine protease inhibitor whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. Defects in this gene can cause emphysema or liver disease. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
  • Other Designations:
  • protease inhibitor 1 (anti-elastase), alpha-1-antitrypsin,serine (or cysteine) proteinase inhibitor, clade A, member 1,serine proteinase inhibitor, clade A, member 1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook