Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PHKA2 polyclonal antibody (A01)

  • Catalog # : H00005256-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PHKA2.
  • Immunogen:
  • PHKA2 (NP_000283, 428 a.a. ~ 521 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • RRFSTSVKPDVVVQVTVLAENNHIKDLLRKHGVNVQSIADIHPIQVQPGRILSHIYAKLGRNKNMNLSGRPYRHIGVLGTSKLYVIRNQIFTFT
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5256
  • Gene Name:
  • PHKA2
  • Gene Alias:
  • GSD9A,MGC133071,PHK,PYK,PYKL,XLG,XLG2
  • Gene Description:
  • phosphorylase kinase, alpha 2 (liver)
  • Other Designations:
  • OTTHUMP00000023007,Phosphorylase kinase deficiency, liver (glycogen storage disease,dJ499B10.2 (phosphorylase kinase, alpha 2 (liver) (PYK)),phosphorylase kinase alpha-subunit,phosphorylase kinase, alpha 2 (liver), glycogen storage disease IX
  • RSS
  • YouTube
  • Linkedin
  • Facebook