PHKA1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant PHKA1.
Immunogen
PHKA1 (NP_002628, 631 a.a. ~ 730 a.a) partial recombinant protein with GST tag.
Sequence
DYDDNYDYLESGNWMNDYDSTSHARCGDEVARYLDHLLAHTAPHPKLAPTSQKGGLDRFQAAVQTTCDLMSLVTKAKELHVQNVHMYLPTKLFQASRPSF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — PHKA1
Entrez GeneID
5255GeneBank Accession#
NM_002637Protein Accession#
NP_002628Gene Name
PHKA1
Gene Alias
MGC132604, PHKA
Gene Description
phosphorylase kinase, alpha 1 (muscle)
Gene Ontology
HyperlinkGene Summary
The PHKA1 gene encodes the alpha subunit of muscle phosphorylase kinase (EC 2.7.1.38), a key regulatory enzyme of glycogen metabolism. Phosphorylase kinase consists of 4 copies of an alpha-beta-gamma-delta tetramer. The alpha, beta (PHKB; MIM 172490), and gamma (PHKG1; MIM 172470 and PHKG2; MIM 172471) subunits have several isoforms; the delta subunit is calmodulin (CALM1; MIM 114180). PHKA2 (MIM 306000) encodes the alpha subunit of liver-specific phosphorylase kinase and is also located on the X chromosome.[supplied by OMIM
Other Designations
OTTHUMP00000024287|phosphorylase kinase, alpha 1 (muscle), muscle glycogenosis
-
Interactome
-
Pathway
-
Publication Reference
-
A kinome-targeted RNAi-based screen links FGF signaling to H2AX phosphorylation in response to radiation.
Benzina S, Pitaval A, Lemercier C, Lustremant C, Frouin V, Wu N, Papine A, Soussaline F, Romeo PH, Gidrol X.
Cellular and Molecular Life Sciences 2015 Sep; 72(18):3559.
Application:WB, Human, HaCaT cells.
-
{alpha}-Actinin-3 deficiency results in reduced glycogen phosphorylase activity and altered calcium handling in skeletal muscle.
Quinlan KG, Seto JT, Turner N, Vandebrouck A, Floetenmeyer M, Macarthur DG, Raftery JM, Lek M, Yang N, Parton RG, Cooney GJ, North KN.
Human Molecular Genetics 2010 Apr; 19(7):1335.
Application:WB-Ti, Mouse, Mouse skeletal muscles.
-
A kinome-targeted RNAi-based screen links FGF signaling to H2AX phosphorylation in response to radiation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com