SLC25A3 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SLC25A3 expression in transfected 293T cell line (H00005250-T03) by SLC25A3 MaxPab polyclonal antibody.
Lane 1: SLC25A3 transfected lysate(39.71 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to SLC25A3 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human SLC25A3 protein.
Immunogen
SLC25A3 (NP_002626.1, 1 a.a. ~ 361 a.a) full-length human protein.
Sequence
MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEYSCEFGSAKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGLTQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (91)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SLC25A3 expression in transfected 293T cell line (H00005250-T03) by SLC25A3 MaxPab polyclonal antibody.
Lane 1: SLC25A3 transfected lysate(39.71 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to SLC25A3 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — SLC25A3
Entrez GeneID
5250GeneBank Accession#
BC004345Protein Accession#
NP_002626.1Gene Name
SLC25A3
Gene Alias
OK/SW-cl.48, PHC
Gene Description
solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene catalyzes the transport of phosphate into the mitochondrial matrix, either by proton cotransport or in exchange for hydroxyl ions. The protein contains three related segments arranged in tandem which are related to those found in other characterized members of the mitochondrial carrier family. Both the N-terminal and C-terminal regions of this protein protrude toward the cytosol. Multiple alternatively spliced transcript variants have been isolated. [provided by RefSeq
Other Designations
mitochondrial carrier|mitochondrial phosphate carrier protein|phosphate carrier|solute carrier family 25 member 3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com