PGR monoclonal antibody (M01), clone 3E11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PGR. This PGR gene uses two distinct promoters and translation start sites in the first exon to produce two isoforms, A and B. The two isoforms are identical except for the additional 165 amino acids found in the N-terminus of isoform B. Our immunogen corresponds to the specific region of isoform B, thus this antibody is a PGR isofrom B specific antibody.
Immunogen
PGR (NP_000917, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGL
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (62); Rat (60)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PGR monoclonal antibody (M01), clone 3E11 Western Blot analysis of PGR expression in MCF-7 ( Cat # L046V1 ).Western Blot (Cell lysate)
PGR monoclonal antibody (M01), clone 3E11. Western Blot analysis of PGR expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PGR on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PGR is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PGR on MCF-7 cell . [antibody concentration 10 ug/ml] -
Gene Info — PGR
Entrez GeneID
5241GeneBank Accession#
NM_000926Protein Accession#
NP_000917Gene Name
PGR
Gene Alias
NR3C3, PR
Gene Description
progesterone receptor
Omim ID
607311Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the steroid receptor superfamily. The encoded protein mediates the physiological effects of progesterone, which plays a central role in reproductive events associated with the establishment and maintenance of pregnancy. This gene uses two distinct promotors and translation start sites in the first exon to produce two isoforms, A and B. The two isoforms are identical except for the additional 165 amino acids found in the N-terminus of isoform A only, and mediate their own response genes and physiologic effects with little overlap. The location of transcription initiation for isoform B has not been clearly determined. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
-
Publication Reference
-
Effect of isoflavones on breast cancer cell development and their impact on breast cancer treatments.
Minami Hatono, Hirokuni Ikeda, Yoko Suzuki, Yukiko Kajiwara, Kengo Kawada, Takahiro Tsukioki, Mariko Kochi, Ken Suzawa, Takayuki Iwamoto, Hiromasa Yamamoto, Tadahiko Shien, Masaomi Yamane, Naruto Taira, Hiroyoshi Doihara and Shinichi Toyooka.
Breast Cancer Research and Treatment 2021 Jan; 185(2):307.
Application:WB, Human, MCF-7, MDAMB-231, T-47D, ZR-75–1 cells.
-
Effect of isoflavones on breast cancer cell development and their impact on breast cancer treatments.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com