Product Browser

Last updated: 2017/8/20
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PGK1 polyclonal antibody (A01)

  • Catalog # : H00005230-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PGK1.
  • Immunogen:
  • PGK1 (NP_000282, 321 a.a. ~ 417 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • SKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSNI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005230-A01
    Western Blot detection against Immunogen (36.78 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • PGK1 polyclonal antibody (A01), Lot # 060927JCS1 Western Blot analysis of PGK1 expression in MES-SA/Dx5 ( Cat # L021V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5230
  • Gene Name:
  • PGK1
  • Gene Alias:
  • MGC117307,MGC142128,MGC8947,MIG10,PGKA
  • Gene Description:
  • phosphoglycerate kinase 1
  • Gene Summary:
  • The protein encoded by this gene is a glycolytic enzyme that catalyzes the conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate. The encoded protein may also act as a cofactor for polymerase alpha. This gene lies on the X-chromosome, while a related pseudogene also has been found on the X-chromosome and another on chromosome 19. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000023595,cell migration-inducing gene 10 protein,primer recognition protein 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook