PGF purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PGF expression in transfected 293T cell line (H00005228-T01) by PGF MaxPab polyclonal antibody.
Lane 1: PGF transfected lysate(19.30 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between PGF and VEGFA. HeLa cells were stained with anti-PGF rabbit purified polyclonal 1:1200 and anti-VEGFA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human PGF protein.
Immunogen
PGF (NP_002623.2, 1 a.a. ~ 170 a.a) full-length human protein.
Sequence
MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (66); Rat (62)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PGF expression in transfected 293T cell line (H00005228-T01) by PGF MaxPab polyclonal antibody.
Lane 1: PGF transfected lysate(19.30 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between PGF and VEGFA. HeLa cells were stained with anti-PGF rabbit purified polyclonal 1:1200 and anti-VEGFA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — PGF
Entrez GeneID
5228GeneBank Accession#
NM_002632Protein Accession#
NP_002623.2Gene Name
PGF
Gene Alias
D12S1900, PGFL, PLGF, PlGF-2, SHGC-10760
Gene Description
placental growth factor
Omim ID
601121Gene Ontology
HyperlinkGene Summary
vascular endothelial growth factor-related protein|placental growth factor-like
Other Designations
placenta growth factor|placental growth factor, vascular endothelial growth factor-related protein|placental growth factor-like
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com