Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PGF purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00005228-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human PGF protein.
  • Immunogen:
  • PGF (NP_002623.2, 1 a.a. ~ 170 a.a) full-length human protein.
  • Sequence:
  • MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PGF expression in transfected 293T cell line (H00005228-T01) by PGF MaxPab polyclonal antibody.

    Lane 1: PGF transfected lysate(18.7 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlargeenlarge this image
  • Immunoperoxidase of purified MaxPab antibody to PGF on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 3 ug/ml]
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 5228
  • Gene Name:
  • PGF
  • Gene Alias:
  • D12S1900,PGFL,PLGF,PlGF-2,SHGC-10760
  • Gene Description:
  • placental growth factor
  • Other Designations:
  • placenta growth factor,placental growth factor, vascular endothelial growth factor-related protein,placental growth factor-like
  • RSS
  • YouTube
  • Linkedin
  • Facebook