PGD monoclonal antibody (M01J), clone 1G12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PGD expression in transfected 293T cell line by PGD monoclonal antibody (M01), clone 1G12.
Lane 1: PGD transfected lysate(53.1 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PGD on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]
RNAi Knockdown (Antibody validated)
Western blot analysis of PGD over-expressed 293 cell line, cotransfected with PGD Validated Chimera RNAi ( Cat # H00005226-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PGD monoclonal antibody (M01), clone 1G12 (Cat # H00005226-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Immunofluorescence
Immunofluorescence of monoclonal antibody to PGD on A-431 cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (78.87 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant PGD.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
PGD (AAH00368, 1 a.a. ~ 483 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNA
Host
Mouse
Reactivity
Human
Preparation Method
Cell Culture Production
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (78.87 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PGD expression in transfected 293T cell line by PGD monoclonal antibody (M01), clone 1G12.
Lane 1: PGD transfected lysate(53.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PGD on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of PGD over-expressed 293 cell line, cotransfected with PGD Validated Chimera RNAi ( Cat # H00005226-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PGD monoclonal antibody (M01), clone 1G12 (Cat # H00005226-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to PGD on A-431 cell. [antibody concentration 10 ug/ml] -
Gene Info — PGD
Entrez GeneID
5226GeneBank Accession#
BC000368Protein Accession#
AAH00368Gene Name
PGD
Gene Alias
6PGD
Gene Description
phosphogluconate dehydrogenase
Omim ID
172200Gene Ontology
HyperlinkGene Summary
6-phosphogluconate dehydrogenase is the second dehydrogenase in the pentose phosphate shunt. Deficiency of this enzyme is generally asymptomatic, and the inheritance of this disorder is autosomal dominant. Hemolysis results from combined deficiency of 6-phosphogluconate dehydrogenase and 6-phosphogluconolactonase suggesting a synergism of the two enzymopathies. [provided by RefSeq
Other Designations
6-phosphogluconate dehydrogenase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com