PGAM1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PGAM1 full-length ORF ( AAH11678.1, 1 a.a. - 254 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
53.68
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PGAM1
Entrez GeneID
5223GeneBank Accession#
BC011678Protein Accession#
AAH11678.1Gene Name
PGAM1
Gene Alias
PGAM-B, PGAMA
Gene Description
phosphoglycerate mutase 1 (brain)
Omim ID
172250Gene Ontology
HyperlinkGene Summary
nonmuscle form
Other Designations
OTTHUMP00000020190|OTTHUMP00000059414|phosphoglycerate mutase A, nonmuscle form
-
Interactome
-
Pathway
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Glycolysis / Gluconeogenesis
- Metabolic pathways
-
Publication Reference
-
Relationship between circulating tumor-associated autoantibodies and clinical outcomes in advanced-stage NSCLC patients receiving PD-1/-L1 directed immune checkpoint inhibition.
Imad Tarhoni, Connor J Wakefield, Revathi Kollipara, Mary Jo Fidler, Marta Batus, Philip Bonomi, Jeffrey A Borgia.
Journal of Immunological Methods 2021 Jan; 490:112956.
Application:Conjugation, Human, Beads, Human serum.
-
High prevalence of autoantibodies against phosphoglycerate mutase 1 in patients with autoimmune central nervous system diseases.
Kimura A, Sakurai T, Koumura A, Yamada M, Hayashi Y, Tanaka Y, Hozumi I, Tanaka R, Takemura M, Seishima M, Inuzuka T.
Journal of Neuroimmunology 2009 Dec; 219(1-2):105.
Application:WB, Human, Serum from patients with multiple sclerosis.
-
Relationship between circulating tumor-associated autoantibodies and clinical outcomes in advanced-stage NSCLC patients receiving PD-1/-L1 directed immune checkpoint inhibition.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com