Product Browser

Last updated: 2017/5/28
  • Related Product Showcase
  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PFN2 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00005217-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human PFN2 protein.
  • Immunogen:
  • PFN2 (AAH18049.1, 1 a.a. ~ 140 a.a) full-length human protein.
  • Sequence:
  • MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLALGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PFN2 expression in transfected 293T cell line (H00005217-T01) by PFN2 MaxPab polyclonal antibody.

    Lane 1: PFN2 transfected lysate(15 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 5217
  • Gene Name:
  • PFN2
  • Gene Alias:
  • D3S1319E,PFL
  • Gene Description:
  • profilin 2
  • Gene Summary:
  • The protein encoded by this gene is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. There are two alternatively spliced transcript variants encoding different isoforms described for this gene. [provided by RefSeq
  • Other Designations:
  • profilin-2
  • RSS
  • YouTube
  • Linkedin
  • Facebook