PFN1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PFN1 polyclonal antibody (A01), Lot # Abnova060427QCS1. Western Blot analysis of PFN1 expression in Raw 264.7.
Western Blot (Cell lysate)
PFN1 polyclonal antibody (A01), Lot # Abnova060427QCS1 Western Blot analysis of PFN1 expression in HeLa ( Cat # L013V1 ).
Western Blot detection against Immunogen (41.51 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length recombinant PFN1.
Immunogen
PFN1 (AAH06768, 1 a.a. ~ 140 a.a) full-length recombinant protein with GST tag.
Sequence
MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY
Host
Mouse
Reactivity
Human, Mouse
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (41.51 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PFN1 polyclonal antibody (A01), Lot # Abnova060427QCS1. Western Blot analysis of PFN1 expression in Raw 264.7.Western Blot (Cell lysate)
PFN1 polyclonal antibody (A01), Lot # Abnova060427QCS1 Western Blot analysis of PFN1 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — PFN1
Entrez GeneID
5216GeneBank Accession#
BC006768Protein Accession#
AAH06768Gene Name
PFN1
Gene Alias
-
Gene Description
profilin 1
Omim ID
176610Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Publication Reference
-
Profilin2 is required for filamentous actin formation induced by human parainfluenza virus type 2.
Ohta K, Matsumoto Y, Nishio M.
Virology 2019 Jul; 533:108.
Application：WB-Tr, Human, Monkey, HEK 293, COS cells.
-
Profilin2 is required for filamentous actin formation induced by human parainfluenza virus type 2.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com