Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ATP8B1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00005205-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ATP8B1 partial ORF ( NP_005594.1, 471 a.a. - 551 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • INGQIYGDHRDASQHNHNKIEQVDFSWNTYADGKLAFYDHYLIEQIQSGKEPEVRQFFFLLAVCHTVMVDRTDGQLNYQAA
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 34.65
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005205-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5205
  • Gene Name:
  • ATP8B1
  • Gene Alias:
  • ATPIC,BRIC,FIC1,PFIC,PFIC1
  • Gene Description:
  • ATPase, class I, type 8B, member 1
  • Gene Summary:
  • This gene encodes a member of the P-type cation transport ATPase family, which belongs to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. Mutations in this gene may result in progressive familial intrahepatic cholestasis type 1 and in benign recurrent intrahepatic cholestasis. [provided by RefSeq
  • Other Designations:
  • E1-E2 ATPase,OTTHUMP00000163615,phospholipid-transporting ATPase IC
  • RSS
  • YouTube
  • Linkedin
  • Facebook