PFDN5 purified MaxPab mouse polyclonal antibody (B03P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
PFDN5 MaxPab polyclonal antibody. Western Blot analysis of PFDN5 expression in human pancreas.
Western Blot (Transfected lysate)
Western Blot analysis of PFDN5 expression in transfected 293T cell line (H00005204-T01) by PFDN5 MaxPab polyclonal antibody.
Lane 1: PFDN5 transfected lysate(16.94 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to PFDN5 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PFDN5 protein.
Immunogen
PFDN5 (-, 1 a.a. ~ 154 a.a) full-length human protein.
Sequence
MAQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQATAKA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PFDN5 MaxPab polyclonal antibody. Western Blot analysis of PFDN5 expression in human pancreas.Western Blot (Transfected lysate)
Western Blot analysis of PFDN5 expression in transfected 293T cell line (H00005204-T01) by PFDN5 MaxPab polyclonal antibody.
Lane 1: PFDN5 transfected lysate(16.94 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to PFDN5 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PFDN5
Entrez GeneID
5204GeneBank Accession#
BC003373Protein Accession#
-Gene Name
PFDN5
Gene Alias
MGC5329, MGC71907, MM-1, MM1, PFD5
Gene Description
prefoldin subunit 5
Omim ID
604899Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the prefoldin alpha subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. The encoded protein may also repress the transcriptional activity of the proto-oncogene c-Myc. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq
Other Designations
c-myc binding protein|myc modulator-1|prefoldin 5
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com