PFDN5 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PFDN5 polyclonal antibody (A01), Lot # 050927JC01 Western Blot analysis of PFDN5 expression in 293 ( Cat # L026V1 ).
Western Blot detection against Immunogen (37.11 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant PFDN5.
Immunogen
PFDN5 (NP_002615, 40 a.a. ~ 139 a.a) partial recombinant protein with GST tag.
Sequence
QTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (99)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PFDN5 polyclonal antibody (A01), Lot # 050927JC01 Western Blot analysis of PFDN5 expression in 293 ( Cat # L026V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — PFDN5
Entrez GeneID
5204GeneBank Accession#
NM_002624Protein Accession#
NP_002615Gene Name
PFDN5
Gene Alias
MGC5329, MGC71907, MM-1, MM1, PFD5
Gene Description
prefoldin subunit 5
Omim ID
604899Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the prefoldin alpha subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. The encoded protein may also repress the transcriptional activity of the proto-oncogene c-Myc. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq
Other Designations
c-myc binding protein|myc modulator-1|prefoldin 5
-
Interactome
-
Publication Reference
-
Prefoldin Subunits Are Protected from Ubiquitin-Proteasome System-mediated Degradation by Forming Complex with Other Constituent Subunits.
Miyazawa M, Tashiro E, Kitaura H, Maita H, Suto H, Iguchi-Ariga SM, Ariga H.
J Biol Chem 2011 Apr; 286:19191.
Application：WB-Tr, Human, Mouse, HeLa, H1299, HepG2, MEF, Neuro-2a, NIH3T3 cells.
-
Negative regulation of the Wnt signal by MM-1 through inhibiting expression of the wnt4 gene.
Yoshida T, Kitaura H, Hagio Y, Sato T, Iguchi-Ariga SM, Ariga H.
Experimental Cell Research 2008 Jan; 314(6):1217.
Application：WB-Tr, Human, H1299 cells.
-
Prefoldin Subunits Are Protected from Ubiquitin-Proteasome System-mediated Degradation by Forming Complex with Other Constituent Subunits.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com