Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PEX14 (Human) Recombinant Protein (Q01)

  • Catalog # : H00005195-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PEX14 partial ORF ( NP_004556.1, 293 a.a. - 375 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • LGPQEEGEGVVDVKGQVRMEVQGEEEKREDKEDEEDEEDDDVSHVDEEDCLGVQREDRRGGDGQINEQVEKLRRPEGASNESE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 34.87
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005195-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5195
  • Gene Name:
  • PEX14
  • Gene Alias:
  • MGC12767,NAPP2,Pex14p,dJ734G22.2
  • Gene Description:
  • peroxisomal biogenesis factor 14
  • Gene Summary:
  • This gene encodes an essential component of the peroxisomal import machinery. The protein is integrated into peroxisome membranes with its C-terminus exposed to the cytosol, and interacts with the cytosolic receptor for proteins containing a PTS1 peroxisomal targeting signal. The protein also functions as a transcriptional corepressor and interacts with a histone deacetylase. A mutation in this gene results in one form of Zellweger syndrome. [provided by RefSeq
  • Other Designations:
  • NF-E2 associated polypeptide 2,OTTHUMP00000001902,PTS1 receptor docking protein,peroxin-14,peroxisomal membrane anchor protein Pex14p
  • RSS
  • YouTube
  • Linkedin
  • Facebook