Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PEX10 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00005192-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human PEX10 protein.
  • Immunogen:
  • PEX10 (NP_722540.1, 1 a.a. ~ 346 a.a) full-length human protein.
  • Sequence:
  • MAPAAASPPEVIRAAQKDEYYRGGLRSAAGGALHSLAGARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIIQVDPSRIHVPSSLRRGVLVTLHAVLPYLLDKALLPLEQELQADPDSGRPLQGSLGPGGRGCSGARRWMRHHTATLTEQQRRALLRAVFVLRQGLACLQRLHVAWFYIHGVFYHLAKRLTGITYQALRPDPLRVLMSVAPSALQLRVRSLPGEDLRARVSYRLLGVISLLHLVLSMGLQLYGFRQRQRARKEWRLHRGLSHRRASLEERAVSRNPLCTLCLEERRHPTATPCGHLFCWECITAWCSSKAECPLCREKFPPQKLIYLRHYR
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of PEX10 transfected lysate using anti-PEX10 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PEX10 monoclonal antibody (M01), clone 1B8 (H00005192-M01).
  • PDF DownloadProtocol Download
  • Application Image
  • Gene Information
  • Entrez GeneID:
  • 5192
  • Gene Name:
  • PEX10
  • Gene Alias:
  • MGC1998,NALD,RNF69
  • Gene Description:
  • peroxisomal biogenesis factor 10
  • Gene Summary:
  • This gene encodes a protein involved in import of peroxisomal matrix proteins. This protein localizes to the peroxisomal membrane. Mutations in this gene result in phenotypes within the Zellweger spectrum of peroxisomal biogenesis disorders, ranging from neonatal adrenoleukodystrophy to Zellweger syndrome. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000001658,peroxin 10,peroxisome assembly protein 10,peroxisome biogenesis factor 10
  • RSS
  • YouTube
  • Linkedin
  • Facebook