ENPP3 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ENPP3 partial ORF ( NP_005012, 602 a.a. - 699 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
ATVKVNLPFGRPRVLQKNVDHCLLYHREYVSGFGKAMRMPMWSSYTVPQLGDTSPLPPTVPDCLRADVRVPPSESQKCSFYLADKNITHGFLYPPASN
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.52
Interspecies Antigen Sequence
Mouse (87); Rat (89)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ENPP3
Entrez GeneID
5169GeneBank Accession#
NM_005021Protein Accession#
NP_005012Gene Name
ENPP3
Gene Alias
B10, CD203c, NPP3, PD-IBETA, PDNP3
Gene Description
ectonucleotide pyrophosphatase/phosphodiesterase 3
Omim ID
602182Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to a series of ectoenzymes that are involved in hydrolysis of extracellular nucleotides. These ectoenzymes possess ATPase and ATP pyrophosphatase activities and are type II transmembrane proteins. Expression of the related rat mRNA has been found in a subset of immature glial cells and in the alimentary tract. The corresponding rat protein has been detected in the pancreas, small intestine, colon, and liver. The human mRNA is expressed in glioma cells, prostate, and uterus. Expression of the human protein has been detected in uterus, basophils, and mast cells. [provided by RefSeq
Other Designations
OTTHUMP00000040272|dJ1005H11.3 (phosphodiesterase I/nucleotide pyrophosphatase 3)|dJ914N13.3 (phosphodiesterase I/nucleotide pyrophosphatase 3)|gp130RB13-6|phosphodiesterase I/nucleotide pyrophosphatase 3|phosphodiesterase-I beta
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com