Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ENPP1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00005167-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ENPP1 partial ORF ( AAH59375, 816 a.a. - 925 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • KRRVIRNQEILIPTHFFIVLTSCKDTSQTPLHCENLDTLAFILPHRTDNSESCVHGKHDSSWVEELLMLHRARITDVEHITGLSFYQQRKEPVSDILKLKTHLPTFSQED
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005167-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5167
  • Gene Name:
  • ENPP1
  • Gene Alias:
  • M6S1,NPP1,NPPS,PC-1,PCA1,PDNP1
  • Gene Description:
  • ectonucleotide pyrophosphatase/phosphodiesterase 1
  • Gene Summary:
  • This gene is a member of the ecto-nucleotide pyrophosphatase/phosphodiesterase (ENPP) family. The encoded protein is a type II transmembrane glycoprotein comprising two identical disulfide-bonded subunits. This protein has broad specificity and cleaves a variety of substrates, including phosphodiester bonds of nucleotides and nucleotide sugars and pyrophosphate bonds of nucleotides and nucleotide sugars. This protein may function to hydrolyze nucleoside 5' triphosphates to their corresponding monophosphates and may also hydrolyze diadenosine polyphosphates. Mutations in this gene have been associated with 'idiopathic' infantile arterial calcification, ossification of the posterior longitudinal ligament of the spine (OPLL), and insulin resistance. [provided by RefSeq
  • Other Designations:
  • Ly-41 antigen,OTTHUMP00000043194,alkaline phosphodiesterase 1,membrane component, chromosome 6, surface marker 1,phosphodiesterase I/nucleotide pyrophosphatase 1,plasma-cell membrane glycoprotein 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook