PDK3 monoclonal antibody (M01), clone 2B11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PDK3.
Immunogen
PDK3 (AAH15948, 174 a.a. ~ 263 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GDTNPVHPKHIGSIDPTCNVADVVKDAYETAKMLCEQYYLVAPELEVEEFNAKAPDKPIQVVYVPSHLFHMLFELFKNSMRATVELYEDR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (97)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.31 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PDK3 monoclonal antibody (M01), clone 2B11 Western Blot analysis of PDK3 expression in MCF-7 ( Cat # L046V1 ).Western Blot (Transfected lysate)
Western Blot analysis of PDK3 expression in transfected 293T cell line by PDK3 monoclonal antibody (M01), clone 2B11.
Lane 1: PDK3 transfected lysate(46.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PDK3 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — PDK3
-
Interactome
-
Publication Reference
-
Additive effects of clofibric acid and pyruvate dehydrogenase kinase isoenzyme 4 (PDK4) deficiency on hepatic steatosis in mice fed a high saturated fat diet.
Hwang B, Wu P, Harris RA.
The FEBS Journal 2012 May; 279(10):1883.
Application:WB-Ti, Mouse, Liver.
-
Induction of pyruvate dehydrogenase kinase-3 by hypoxia-inducible factor-1 promotes metabolic switch and drug resistance.
Lu CW, Lin SC, Chen KF, Lai YY, Tsai SJ.
The Journal of Biological Chemistry 2008 Aug; 283(42):28106.
-
Pyruvate Dehydrogenase Kinase 4 (PDK4) Deficiency Lowers Blood Glucose and Improves Glucose Tolerance in Diet-Induced Obese Mice.
Jeoung NH, Harris RA.
American Journal of Physiology. Endocrinology and Metabolism 2008 Apr; 295(1):E46.
Application:WB, Mouse, Mouse liver, kindey.
-
Additive effects of clofibric acid and pyruvate dehydrogenase kinase isoenzyme 4 (PDK4) deficiency on hepatic steatosis in mice fed a high saturated fat diet.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com