PDHB monoclonal antibody (M03), clone 2B2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PDHB.
Immunogen
PDHB (NP_000916, 250 a.a. ~ 359 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LEAAAVLSKEGVECEVINMRTIRPMDMETIEASVMKTNHLVTVEGGWPQFGVGAEICARIMEGPAFNFLDAPAVRVTGADVPMPYAKILEDNSIPQVKDIIFAIKKTLNI
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PDHB monoclonal antibody (M03), clone 2B2 Western Blot analysis of PDHB expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of PDHB expression in transfected 293T cell line by PDHB monoclonal antibody (M03), clone 2B2.
Lane 1: PDHB transfected lysate(39.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PDHB on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PDHB is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — PDHB
Entrez GeneID
5162GeneBank Accession#
NM_000925Protein Accession#
NP_000916Gene Name
PDHB
Gene Alias
DKFZp564K0164, PHE1B
Gene Description
pyruvate dehydrogenase (lipoamide) beta
Omim ID
179060Gene Ontology
HyperlinkGene Summary
E1 beta polypeptide
Other Designations
Pyruvate dehydrogenase, E1 beta polypeptide
-
Interactome
-
Pathway
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Butanoate metabolism
- Citrate cycle (TCA cycle)
+ View More Disease
-
Publication Reference
-
Aconitase 2 inhibits the proliferation of MCF-7 cells promoting mitochondrial oxidative metabolism and ROS/FoxO1-mediated autophagic response.
Ciccarone F, Di Leo L, Lazzarino G, Maulucci G, Di Giacinto F, Tavazzi B, Ciriolo MR.
British Journal of Cancer 2020 Jan; 122(2):182.
Application:WB-Tr, Human, MCF-7 cells.
-
Proteomics of uveal melanomas suggests HSP-27 as a possible surrogate marker of chromosome 3 loss.
Coupland SE, Vorum H, Mandal N, Kalirai H, Honore B, Urbak SF, Lake SL, Dopierala J, Damato B.
Investigative Ophthalmology & Visual Science 2010 Jan; 51(1):12.
Application:WB-Ti, Human, Human melanoma tissues.
-
Aconitase 2 inhibits the proliferation of MCF-7 cells promoting mitochondrial oxidative metabolism and ROS/FoxO1-mediated autophagic response.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com