PDHA2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human PDHA2 protein.
Immunogen
PDHA2 (NP_005381.1, 1 a.a. ~ 388 a.a) full-length human protein.
Sequence
MLAAFISRVLRRVAQKSARRVLVASRNSSNDATFEIKKCDLYLLEEGPPVTTVLTRAEGLKYYRMMLTVRRMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHGVCYTRGLSVRSILAELTGRRGGCAKGKGGSMHMYTKNFYGGNGIVGAQGPLGAGIALACKYKGNDEICLTLYGDGAANQGQIAEAFNMAALWKLPCVFICENNLYGMGTSTERAAASPDYYKRGNFIPGLKVDGMDVLCVREATKFAANYCRSGKGPILMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKRDPIIILQDRMVNSKLATVEELKEIGAEVRKEIDDAAQFATTDPEPHLEELGHHIYSSDSSFEVRGANPWIKFKSVS
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PDHA2 MaxPab rabbit polyclonal antibody. Western Blot analysis of PDHA2 expression in mouse testis.Western Blot (Cell lysate)
PDHA2 MaxPab rabbit polyclonal antibody. Western Blot analysis of PDHA2 expression in A-431.Western Blot (Transfected lysate)
Western Blot analysis of PDHA2 expression in transfected 293T cell line (H00005161-T02) by PDHA2 MaxPab polyclonal antibody.
Lane 1: PDHA2 transfected lysate(42.90 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to PDHA2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PDHA2
Entrez GeneID
5161GeneBank Accession#
NM_005390.3Protein Accession#
NP_005381.1Gene Name
PDHA2
Gene Alias
MGC149517, MGC149518, PDHAL
Gene Description
pyruvate dehydrogenase (lipoamide) alpha 2
Omim ID
179061Gene Ontology
HyperlinkGene Summary
E1-alpha polypeptide
Other Designations
pyruvate dehydrogenase, E1-alpha polypeptide, testis specific
-
Interactome
-
Pathway
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Butanoate metabolism
- Citrate cycle (TCA cycle)
+ View More Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com