Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PDE9A (Human) Recombinant Protein (Q01)

  • Catalog # : H00005152-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PDE9A partial ORF ( NP_001001567.1, 434 a.a. - 533 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • EGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRIDDAMKELQKKTDSLTSGATEKSRERSRDVKNSEGDCA
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005152-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5152
  • Gene Name:
  • PDE9A
  • Gene Alias:
  • HSPDE9A2
  • Gene Description:
  • phosphodiesterase 9A
  • Gene Summary:
  • The protein encoded by this gene catalyzes the hydrolysis of cAMP and cGMP to their corresponding monophosphates. The encoded protein plays a role in signal transduction by regulating the intracellular concentration of these cyclic nucleotides. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • CGMP-specific 3',5'-cyclic phosphodiesterase type 9,OTTHUMP00000109390,OTTHUMP00000109391,OTTHUMP00000109393,OTTHUMP00000109394,OTTHUMP00000109397,OTTHUMP00000109399,OTTHUMP00000109400,phosphodiesterase PDE9A21
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook