PDE8A monoclonal antibody (M02), clone 1H6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PDE8A expression in transfected 293T cell line by PDE8A monoclonal antibody (M02), clone 1H6.
Lane 1: PDE8A transfected lysate(93.3 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PDE8A is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.64 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PDE8A.
Immunogen
PDE8A (NP_002596.1, 32 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RLPQGQKTAALPRTRGAGLLESELRDGSGKKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACFL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (81); Rat (82)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PDE8A expression in transfected 293T cell line by PDE8A monoclonal antibody (M02), clone 1H6.
Lane 1: PDE8A transfected lysate(93.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PDE8A is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — PDE8A
Entrez GeneID
5151GeneBank Accession#
NM_002605Protein Accession#
NP_002596.1Gene Name
PDE8A
Gene Alias
FLJ16150, HsT19550
Gene Description
phosphodiesterase 8A
Omim ID
602972Gene Ontology
HyperlinkGene Summary
Phosphodiesterases (PDEs) regulate the intracellular levels of cAMP and cGMP. These cyclic nucleotides play an important role as second messengers in multiple physiologic processes, including regulation of vascular resistance, cardiac output, visceral motility, immune response, inflammation, neuroplasticity, vision, and reproduction. PDEs comprise a large superfamily of enzymes divided into 10 families. Different PDEs can be distinguished by their structure, tissue expression, localization, substrate specificity, regulation, and sensitivity to PDE inhibitors. Diversity in structure and specificity of function make PDEs promising targets for the pharmacotherapy of diseases modulated by cyclic nucleotide signaling (Hetman et al., MIM 2000). See MIM 171885.[supplied by OMIM
Other Designations
OTTHUMP00000192898|cAMP-specific cyclic nucleotide phosphodiesterase 8A|high-affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com