Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PDE4D (Human) Recombinant Protein (Q01)

  • Catalog # : H00005144-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PDE4D partial ORF ( NP_006194.2, 581 a.a. - 673 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • SPAPDDPEEGRQGQTEKFQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQVEEEAVGEEEESQPEACVIDDRSPDT
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.97
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005144-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5144
  • Gene Name:
  • PDE4D
  • Gene Alias:
  • DPDE3,HSPDE4D,PDE4DN2,STRK1
  • Gene Description:
  • phosphodiesterase 4D, cAMP-specific (phosphodiesterase E3 dunce homolog, Drosophila)
  • Gene Summary:
  • This gene encodes one of four mammalian counterparts to the fruit fly 'dunce' gene. The encoded protein has 3',5'-cyclic-AMP phosphodiesterase activity and degrades cAMP, which acts as a signal transduction molecule in multiple cell types. This gene uses different promoters to generate multiple alternatively spliced transcript variants that encode functional proteins
  • Other Designations:
  • cAMP-specific phosphodiesterase 4D,cAMP-specific phosphodiesterase PDE4D6,dunce-like phosphodiesterase E3,phosphodiesterase 4D, cAMP-specific (dunce
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook