Product Browser

Last updated: 2017/1/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PDE4B (Human) Recombinant Protein (Q01)

  • Catalog # : H00005142-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PDE4B partial ORF ( NP_002591, 637 a.a. - 736 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • DAQDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHSYFSSTKTLCVIDPENRDSLGETDIDIATEDKSPVDT
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005142-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5142
  • Gene Name:
  • PDE4B
  • Gene Alias:
  • DKFZp686F2182,DPDE4,MGC126529,PDE4B5,PDEIVB
  • Gene Description:
  • phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila)
  • Gene Summary:
  • This gene is a member of the type IV, cyclic AMP (cAMP)-specific, cyclic nucleotide phosphodiesterase (PDE) family. Cyclic nucleotides are important second messengers that regulate and mediate a number of cellular responses to extracellular signals, such as hormones, light, and neurotransmitters. The cyclic nucleotide phosphodiesterases (PDEs) regulate the cellular concentrations of cyclic nucleotides and thereby play a role in signal transduction. This gene encodes a protein that specifically hydrolyzes cAMP. Altered activity of this protein has been associated with schizophrenia and bipolar affective disorder. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000010652,OTTHUMP00000010656,OTTHUMP00000046896,cAMP-specific 3',5'-cyclic phosphodiesterase 4B,cAMP-specific phosphodiesterase-4 B isoform,dunce-like phosphodiesterase E4,phosphodiesterase 4B, cAMP-specific,phosphodiesterase 4B, cAMP-specific (d
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook